PDB entry 1g5u

View 1g5u on RCSB PDB site
Description: latex profilin hevb8
Class: allergen
Keywords: Allergen, ACTIN-BINDING PROTEIN
Deposited on 2000-11-02, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.259
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin
    Species: Hevea brasiliensis [TaxId:3981]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LEI8
      • conflict (95)
    Domains in SCOPe 2.06: d1g5ua_
  • Chain 'B':
    Compound: Profilin
    Species: Hevea brasiliensis [TaxId:3981]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LEI8 (Start-130)
      • conflict (95)
    Domains in SCOPe 2.06: d1g5ub_
  • Heterogens: NA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5uA (A:)
    mswqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsl
    aptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmive
    rlgdylldqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5uA (A:)
    swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
    ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
    lgdylldqgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g5uB (B:)
    mswqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsl
    aptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmive
    rlgdylldqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5uB (B:)
    swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
    ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
    lgdylldqgl