PDB entry 1g5t

View 1g5t on RCSB PDB site
Description: the three-dimensional structure of ATP:corrinoid adenosyltransferase from salmonella typhimurium. apo-ATP form
Class: transferase
Keywords: P-loop protein, Cobalamin biosynthesis, RecA fold, TRANSFERASE
Deposited on 2000-11-02, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cob(I)alamin adenosyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g5ta_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5tA (A:)
    msderyqqrqqkvkdrvdarvaqaqeergiiivftgngkgkttaafgtaaravghgknvg
    vvqfikgtwpngernllephgvefqvmatgftwetqnreadtaacmavwqhgkrmladpl
    ldmvvldeltymvaydylpleevisalnarpghqtviitgrgchrdildladtvselrpv
    khafdagvkaqmgidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5tA (A:)
    ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv
    matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa
    lnarpghqtviitgrgchrdildladtvselrpvkha