PDB entry 1g5r

View 1g5r on RCSB PDB site
Description: the three-dimensional structure of ATP:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Class: transferase
Keywords: P-loop protein, Cobalamin biosynthesis, RecA fold, TRANSFERASE
Deposited on 2000-11-02, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cob(I)alamin adenosyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: COBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31570
      • modified residue (86)
      • modified residue (105)
      • modified residue (114)
      • modified residue (122)
      • modified residue (131)
    Domains in SCOPe 2.06: d1g5ra_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5rA (A:)
    msderyqqrqqkvkdrvdarvaqaqeergiiivftgngkgkttaafgtaaravghgknvg
    vvqfikgtwpngernllephgvefqvmatgftwetqnreadtaacmavwqhgkrmladpl
    ldmvvldeltymvaydylpleevisalnarpghqtviitgrgchrdildladtvselrpv
    khafdagvkaqmgidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5rA (A:)
    ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv
    matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa
    lnarpghqtviitgrgchrdildladtvselrpvkha