PDB entry 1g5p

View 1g5p on RCSB PDB site
Description: nitrogenase iron protein from azotobacter vinelandii
Deposited on 2000-11-01, released 2001-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g5pa_
  • Chain 'B':
    Domains in SCOP 1.55: d1g5pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5pA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5pB (B:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev