PDB entry 1g5j

View 1g5j on RCSB PDB site
Description: complex of bcl-xl with peptide from bad
Deposited on 2000-11-01, released 2001-02-07
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1g5ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5jA (A:)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
    felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
    kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerle