PDB entry 1g5j

View 1g5j on RCSB PDB site
Description: complex of bcl-xl with peptide from bad
Class: apoptosis
Keywords: complex, APOPTOSIS
Deposited on 2000-11-01, released 2001-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis regulator bcl-x
    Species: Homo sapiens [TaxId:9606]
    Gene: BCLX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07817 (48-172)
      • cloning artifact (0-3)
      • cloning artifact (173-174)
    Domains in SCOPe 2.08: d1g5ja1, d1g5ja2, d1g5ja3
  • Chain 'B':
    Compound: bad protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92934 (0-24)
      • engineered (19-20)
      • engineered (24)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5jA (A:)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
    felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
    kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerle
    

  • Chain 'B':
    No sequence available.