PDB entry 1g5h

View 1g5h on RCSB PDB site
Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma
Class: DNA binding protein
Keywords: intermolecular four helix bundle, DNA BINDING PROTEIN
Deposited on 2000-11-01, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • modified residue (75)
      • modified residue (225)
      • modified residue (392)
      • modified residue (419)
      • modified residue (422-423)
      • expression tag (443-452)
    Domains in SCOPe 2.07: d1g5ha1, d1g5ha2, d1g5ha3
  • Chain 'B':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • modified residue (75)
      • modified residue (225)
      • modified residue (392)
      • modified residue (419)
      • modified residue (422-423)
      • expression tag (443)
    Domains in SCOPe 2.07: d1g5hb1, d1g5hb2, d1g5hb3
  • Chain 'C':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • modified residue (75)
      • modified residue (225)
      • modified residue (392)
      • modified residue (419)
      • modified residue (422-423)
      • expression tag (443-452)
    Domains in SCOPe 2.07: d1g5hc1, d1g5hc2, d1g5hc3
  • Chain 'D':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • modified residue (75)
      • modified residue (225)
      • modified residue (392)
      • modified residue (419)
      • modified residue (422-423)
      • expression tag (443-451)
    Domains in SCOPe 2.07: d1g5hd1, d1g5hd2, d1g5hd3
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5hA (A:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5hA (A:)
    ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf
    avdslhqepgssqprdsafrlvspesireilqdskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvstrvgekteaslvwftptrtssqwldfwlrh
    rllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgn
    vstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlrkvlklhpclapikvaldvgkg
    ptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlen
    gliqlrsrdttmkemmhisklrdflvkylasasnvaaaldhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g5hB (B:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5hB (B:)
    realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv
    favdslhqepgrdsafrlvspesireilqdrepskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvsrvgekteaslvwftptrtssqwldfwlrhr
    llwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgnv
    stiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlaerkvlklhpclapikvaldvgk
    gptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettle
    ngliqlrsrdttmkemmhisklrdflvkylasasnva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g5hC (C:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5hC (C:)
    ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf
    avdslhqepgssqprdsafrlvspesireilqdskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvstrvgekteaslvwftptrtssqwldfwlrh
    rllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgn
    vstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlrkvlklhpclapikvaldvgkg
    ptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlen
    gliqlrsrdttmkemmhisklrdflvkylasasnvaaaldhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g5hD (D:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5hD (D:)
    realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv
    favdslhqepgrdsafrlvspesireilqdrepskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvsrvgekteaslvwftptrtssqwldfwlrhr
    llwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgnv
    stiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlaensfarkkslqrkvlklhpcla
    pikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlf
    svlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnvaaaldhhhh