PDB entry 1g5a

View 1g5a on RCSB PDB site
Description: amylosucrase from neisseria polysaccharea
Class: transferase
Keywords: glycosyltransferase, glycoside hydrolase, (BETA-ALPHA)8 barrel
Deposited on 2000-10-31, released 2001-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.189
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEU2 (0-627)
      • conflict (0-3)
      • see remark 999 (536)
    Domains in SCOPe 2.07: d1g5aa1, d1g5aa2
  • Heterogens: NA, TRS, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5aA (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
    nlpqahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktvslnqdltlqpyqvmwleia