PDB entry 1g57

View 1g57 on RCSB PDB site
Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase
Deposited on 2000-10-30, released 2001-04-30
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-30, with a file datestamp of 2001-04-30.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1g57a_
  • Chain 'B':
    Domains in SCOP 1.59: d1g57b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g57A (A:)
    llssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsg
    ivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiad
    gakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmar
    apeciefankhnmalvtiedlvayrqahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g57A (A:)
    llssfgtpfervenalaalregrgvmvldenegdmifpaetmtveqmaltirhgsgivcl
    citedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiadgakp
    sdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapec
    iefankhnmalvtiedlvayrqahe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g57B (B:)
    tllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgs
    givclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaia
    dgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtma
    rapeciefankhnmalvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g57B (B:)
    tllssfgtpfervenalaalregrgvmvldnegdmifpaetmtveqmaltirhgsgivcl
    citedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiadgakp
    sdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapec
    iefankhnmalvtiedlvayrqaherkas