PDB entry 1g51

View 1g51 on RCSB PDB site
Description: aspartyl tRNA synthetase from thermus thermophilus at 2.4 a resolution
Class: ligase
Keywords: aminoacyl tRNA synthetase, LIGASE
Deposited on 2000-10-30, released 2000-12-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1g51a1, d1g51a2, d1g51a3
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1g51b1, d1g51b2, d1g51b3
  • Heterogens: SO4, AMO, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g51A (A:)
    mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
    ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeaktppfpvdagwrgeeek
    easeelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfvqvetpfltkstpegar
    dflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrdedlradrqpdftqldl
    emsfvevedvlelnerlmahvfrealgvelplpfprlsyeeamerygsdkpdlrfglelk
    evgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarveeggfs
    ggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglkregfrf
    lwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrvralaydlvlngvevggg
    sirihdprlqarvfrllgigeeeqrekfgfflealeygapphggiawgldrllalmtgsp
    sireviafpknkegkdpltgapspvpeeqlrelglmvvrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g51B (B:)
    mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
    ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeaktppfpvdagwrgeeek
    easeelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfvqvetpfltkstpegar
    dflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrdedlradrqpdftqldl
    emsfvevedvlelnerlmahvfrealgvelplpfprlsyeeamerygsdkpdlrfglelk
    evgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarveeggfs
    ggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglkregfrf
    lwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrvralaydlvlngvevggg
    sirihdprlqarvfrllgigeeeqrekfgfflealeygapphggiawgldrllalmtgsp
    sireviafpknkegkdpltgapspvpeeqlrelglmvvrp