PDB entry 1g50

View 1g50 on RCSB PDB site
Description: crystal structure of a wild type her alpha lbd at 2.9 angstrom resolution
Class: DNA binding protein
Keywords: alpha helices, estradiol, Structural Proteomics in Europe, SPINE, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2000-10-30, released 2002-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.241
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g50a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g50b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g50c_
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g50A (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g50B (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g50B (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g50C (C:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g50C (C:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldah