PDB entry 1g4w

View 1g4w on RCSB PDB site
Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp
Deposited on 2000-10-28, released 2001-01-24
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.26
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1g4wR (R:)
    lldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakqlndy
    vttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtaeleki
    eagapmpqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsyp
    kntpdaleahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssas
    qgeaidqynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknsnqngapgrs
    ssdkhlpmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvql
    kamqaqllm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4wR (R:)
    lldialkglkrtlpqleqmdgnslrplrslmtnlqnlnkqlndyvttltniqvgvarfsq
    weverwvdastheltqavkkihviakelknvtaelekipqtmsgptlglarfavssipin
    qqtqvklsdgmpvpvntltfdgkpvalagsypkntpdaleahmkmllekecsclvvltse
    dqmqakqlppyfrgsytfgevhtnsqkvssasqgeaidqynmqlscgekrytipvlhvkn
    wpdhqplpstdqleyladrvknsnqngapgrsssdkhlpmihclggvgrtgtmaaalvlk
    dnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm