PDB entry 1g4w

View 1g4w on RCSB PDB site
Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp
Class: signaling protein
Keywords: virulence factor, tyrosine phosphatase, GTPase activating protein, 4-helix bundle, disorder, SIGNALING PROTEIN
Deposited on 2000-10-28, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.26
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: protein tyrosine phosphatase sptp
    Species: Salmonella typhimurium [TaxId:602]
    Gene: SPTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4wr1, d1g4wr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1g4wR (R:)
    ndvgaeskqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnk
    ipeakqlndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakel
    knvtaelekieagapmpqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdg
    kpvalagsypkntpdaleahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevh
    tnsqkvssasqgeaidqynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvkn
    snqngapgrsssdkhlpmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrm
    ledasqfvqlkamqaqllmttas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4wR (R:)
    lldialkglkrtlpqleqmdgnslrplrslmtnlqnlnkqlndyvttltniqvgvarfsq
    weverwvdastheltqavkkihviakelknvtaelekipqtmsgptlglarfavssipin
    qqtqvklsdgmpvpvntltfdgkpvalagsypkntpdaleahmkmllekecsclvvltse
    dqmqakqlppyfrgsytfgevhtnsqkvssasqgeaidqynmqlscgekrytipvlhvkn
    wpdhqplpstdqleyladrvknsnqngapgrsssdkhlpmihclggvgrtgtmaaalvlk
    dnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm