PDB entry 1g4u

View 1g4u on RCSB PDB site
Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1
Deposited on 2000-10-28, released 2001-01-24
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1g4uR (R:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4uR (R:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1g4uS (S:)
    ndvgaeskqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnk
    ipeakqlndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakel
    knvtaelekieagapmpqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdg
    kpvalagsypkntpdaleahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevh
    tnsqkvssasqgeaidqynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvkn
    snqngapgrsssdkhlpmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrm
    ledasqfvqlkamqaqllmttas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4uS (S:)
    skqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakq
    lndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtae
    lekieagapmpqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvala
    gsypkntpdaleahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkv
    ssasqgeaidqynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknkhlpmi
    hclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm