PDB entry 1g4r

View 1g4r on RCSB PDB site
Description: crystal structure of bovine beta-arrestin 1
Class: signaling protein
Keywords: Signal transduction, G-proteins, G-protein coupled receptors, SIGNALING PROTEIN
Deposited on 2000-10-27, released 2001-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-arrestin 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4ra1, d1g4ra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g4rA (A:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4rA (A:)
    rvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygre
    dldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpcs
    vtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgpqptaet
    trqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfnt
    aqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstll
    reganreilgiivsykvkvklvvsdlassdvavelpftlmhpkpdivfedfar