PDB entry 1g4m

View 1g4m on RCSB PDB site
Description: crystal structure of bovine beta-arrestin 1
Class: signaling protein
Keywords: Sensory transduction, alternative splicing, SIGNALING PROTEIN
Deposited on 2000-10-27, released 2001-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.235
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-arrestin1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g4ma1, d1g4ma2
  • Chain 'B':
    Compound: beta-arrestin1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g4mb1, d1g4mb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g4mA (A:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4mA (A:)
    gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafryg
    redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp
    csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgpqpta
    ettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclf
    ntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasst
    llreganreilgiivsykvkvklvvsrgsdvavelpftlmhpkpkdddivfedfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g4mB (B:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4mB (B:)
    gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafryg
    redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp
    csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgpqpta
    ettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclf
    ntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasst
    llreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpkdddivfedfar