PDB entry 1g4d

View 1g4d on RCSB PDB site
Description: nmr structure of the mu bacteriophage repressor DNA-binding domain/DNA complex
Class: Viral protein/DNA
Keywords: protein/DNA complex, helix-turn-helix, winged-helix, bacteriophage Mu, repressor, virus/viral protein, Viral protein/DNA COMPLEX
Deposited on 2000-10-26, released 2000-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: repressor protein c
    Species: Enterobacteria phage Mu [TaxId:10677]
    Gene: MU C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g4da_
  • Chain 'B':
    Compound: 5'-d(p*cp*cp*tp*tp*tp*tp*cp*ap*gp*tp*ap*ap*tp*cp*tp*g)-3'
  • Chain 'C':
    Compound: 5'-d(p*cp*ap*gp*ap*tp*tp*ap*cp*tp*gp*ap*ap*ap*ap*gp*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g4dA (A:)
ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq
viahlglst

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.