PDB entry 1g4d

View 1g4d on RCSB PDB site
Description: nmr structure of the mu bacteriophage repressor dna-binding domain/dna complex
Deposited on 2000-10-26, released 2000-11-08
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1g4da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g4dA (A:)
  ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq
  viahlglst