PDB entry 1g4c

View 1g4c on RCSB PDB site
Description: crystal structure of a complex of hppk(r92a) from e.coli with mg2+ at 1.65 angstrom resolution
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, folate, hppk, pterin, 6-hydroxymethyl-7, 8-dihydropterin, antimicrobial agent, drug design, x-ray crystallography, transferase
Deposited on 2000-10-26, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26281
      • engineered (91)
    Domains in SCOPe 2.08: d1g4ca_
  • Chain 'B':
    Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26281 (0-157)
      • engineered (91)
    Domains in SCOPe 2.08: d1g4cb_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g4cA (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgpatldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g4cB (B:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgpatldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw