PDB entry 1g4b

View 1g4b on RCSB PDB site
Description: crystal structures of the hslvu peptidase-ATPase complex reveal an ATP-dependent proteolysis mechanism
Class: chaperone/hydrolase
Keywords: hslvu, peptidase-ATPase complex, chaperone/hydrolase complex
Deposited on 2000-10-26, released 2001-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 7 Å
R-factor: 0.401
AEROSPACI score: -0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4be_
  • Chain 'F':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bf_
  • Chain 'K':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bk_
  • Chain 'L':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bl_
  • Chain 'M':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bm_
  • Chain 'N':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bn_
  • Chain 'O':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bo_
  • Chain 'P':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4bp_

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g4bE (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bE (E:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
    aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
    stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
    itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
    sdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g4bF (F:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bF (F:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
    aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
    stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
    itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
    sdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1g4bK (K:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bK (K:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
    aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
    stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
    itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
    sdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1g4bL (L:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bL (L:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
    aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
    stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
    itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
    sdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1g4bM (M:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bM (M:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1g4bN (N:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bN (N:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1g4bO (O:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bO (O:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1g4bP (P:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4bP (P:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy