PDB entry 1g4a

View 1g4a on RCSB PDB site
Description: crystal structures of the hslvu peptidase-ATPase complex reveal an ATP-dependent proteolysis mechanism
Class: chaperone/hydrolase
Keywords: hslvu, peptidase-ATPase complex, chaperone/hydrolase complex
Deposited on 2000-10-26, released 2001-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.257
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4aa_
  • Chain 'B':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4ab_
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4ac_
  • Chain 'D':
    Compound: ATP-dependent protease hslv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4ad_
  • Chain 'E':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4ae_
  • Chain 'F':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4af_
  • Heterogens: DAT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g4aA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g4aB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g4aC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g4aD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g4aE (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aE (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrges
    sgpdvsregvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlp
    irvelqalttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnest
    enigarrlhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g4aF (F:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aF (F:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrges
    sgpdvsregvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlp
    irvelqalttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnest
    enigarrlhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil