PDB entry 1g47

View 1g47 on RCSB PDB site
Description: 1st lim domain of pinch protein
Class: cell adhesion
Keywords: LIM domain; Zn finger, CELL ADHESION
Deposited on 2000-10-26, released 2001-02-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PINCH protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LIMS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1g47a1, d1g47a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g47A (A:)
    isefmanalasatcerckggfapaekivnsngelyheqcfvcaqcfqqfpeglfyefegr
    kycehdfqmlfapcwil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g47A (A:)
    manalasatcerckggfapaekivnsngelyheqcfvcaqcfqqfpeglfyefegrkyce
    hdfqmlfapc