PDB entry 1g47

View 1g47 on RCSB PDB site
Description: 1st lim domain of pinch protein
Class: cell adhesion
Keywords: LIM domain; Zn finger
Deposited on 2000-10-26, released 2001-02-21
The last revision prior to the SCOP 1.75 freeze date was dated 2001-02-21, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PINCH protein
    Species: HOMO SAPIENS
    Gene: LIMS1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g47a1, d1g47a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1g47A (A:)
isefmanalasatcerckggfapaekivnsngelyheqcfvcaqcfqqfpeglfyefegr
kycehdfqmlfapcwil

    Sequence, based on observed residues (ATOM records): (download) 
    >1g47A (A:)
manalasatcerckggfapaekivnsngelyheqcfvcaqcfqqfpeglfyefegrkyce
hdfqmlfapc