PDB entry 1g43

View 1g43 on RCSB PDB site
Description: crystal structure of a family iiia cbd from clostridium cellulolyticum
Class: structural protein
Keywords: beta-sandwich, STRUCTURAL PROTEIN
Deposited on 2000-10-26, released 2000-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scaffolding protein
    Species: Clostridium cellulolyticum [TaxId:1521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45996 (0-159)
      • see remark 999 (57-58)
    Domains in SCOPe 2.08: d1g43a_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g43A (A:)
    agtgvvsvqfnngsspassnsiyarfkvtntsgspinladlklryyytqdadkpltfwcd
    hagymsgsnyidatskvtgsfkavspavtnadhylevalnsdagslpaggsieiqtrfar
    ndwsnfdqsndwsytaagsymdwqkisafvggtlaygstp