PDB entry 1g41

View 1g41 on RCSB PDB site
Description:
Deposited on 2000-10-25, released 2000-11-22
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.264
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g41a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g41A (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g41A (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftvgkevdsiirdltdsamklvrqqeiaknrlidde
    aaklinpeelkqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegst
    vstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltepha
    slteqykalmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfs
    asdmngqtvnidaayvadalgevvenedlsrfil