PDB entry 1g41

View 1g41 on RCSB PDB site
Description: crystal structure of hslu haemophilus influenzae
Class: chaperone
Keywords: aaa-ATPase, clpy, ATP-dependent proteolysis, chaperone
Deposited on 2000-10-25, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.264
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hslu
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HSLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g41a_
  • Heterogens: SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g41A (A:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g41A (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftvgkevdsiirdltdsamklvrqqeiaknrlidde
    aaklinpeelkqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegst
    vstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltepha
    slteqykalmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfs
    asdmngqtvnidaayvadalgevvenedlsrfil