PDB entry 1g3y

View 1g3y on RCSB PDB site
Description: arg80ala dtxr
Class: gene regulation
Keywords: Dtxr, DNA-binding protein, iron-dependent regulator, GENE REGULATION
Deposited on 2000-10-25, released 2001-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • engineered (79)
    Domains in SCOPe 2.08: d1g3ya1, d1g3ya2, d1g3ya3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3yA (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhalaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3yA (A:)
    dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhalaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkd
    vsrspfgnpipgldelgvpgtrvidaamprkvrivqineifqvetdqftqlldadirvgs
    eveivdrhitlshngkdvellddlahtiriee