PDB entry 1g3w

View 1g3w on RCSB PDB site
Description: cd-cys102ser dtxr
Class: gene regulation
Keywords: DNA binding protein, iron binding protein, iron dependent regulator, GENE REGULATION
Deposited on 2000-10-25, released 2001-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • engineered (101)
    Domains in SCOPe 2.07: d1g3wa1, d1g3wa2, d1g3wa3
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3wA (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3wA (A:)
    lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
    mtptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkdv
    srspfgnpipgldelgvpgtrvidaatsmprkvrivqineifqvetdqftqlldadirvg
    seveivdhitlshngkdvellddlahtirie