PDB entry 1g3u

View 1g3u on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
Deposited on 2000-10-25, released 2001-10-25
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-25, with a file datestamp of 2001-10-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1g3ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g3uA (A:)
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla