PDB entry 1g3t

View 1g3t on RCSB PDB site
Description: cys102ser dtxr
Deposited on 2000-10-25, released 2001-10-25
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-25, with a file datestamp of 2001-10-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.238
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3tA (A:)
    dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkd
    vsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftql
    ldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3tA (A:)
    dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkd
    vsrspfgnpipgldelgvpgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
    gseveivdrhitlshngkdvellddlahtirieel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3tB (B:)
    dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkd
    vsrspfgnpipgldelgv