PDB entry 1g3q

View 1g3q on RCSB PDB site
Description: crystal structure analysis of pyrococcus furiosus cell division ATPase mind
Class: cell cycle, hydrolase
Keywords: ALPHA-BETA-ALPHA layered, PROTEIN-ADP COMPLEX, cell cycle, hydrolase
Deposited on 2000-10-25, released 2001-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division inhibitor
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: MIND
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g3qa_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3qA (A:)
    mgriisivsgkggtgkttvtanlsvalgdrgrkvlavdgdltmanlslvlgvddpdvtlh
    dvlageanvedaiymtqfdnvyvlpgavdwehvlkadprklpevikslkdkfdfilidcp
    aglqldamsamlsgeeallvtnpeiscltdtmkvgivlkkaglailgfvlnrygrsdrdi
    ppeaaedvmevpllavipedpairegtlegipavkykpeskgakafvklaeeiekla