PDB entry 1g3o

View 1g3o on RCSB PDB site
Description: crystal structure of v19e mutant of ferredoxin I
Class: electron transport
Keywords: Iron-sulfur clusters, ferredoxin, electron transport
Deposited on 2000-10-24, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7fe ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • engineered (18)
    Domains in SCOPe 2.07: d1g3oa_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3oA (A:)
    afvvtdncikckytdcveecpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler