PDB entry 1g3n

View 1g3n on RCSB PDB site
Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
Class: cell cycle, signaling protein
Keywords: Cyclin-dependent kinase, INK4 inhibitor, Viral cyclin, cell cycle, signaling protein
Deposited on 2000-10-24, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLIN-DEPENDENT KINASE 6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g3na_
  • Chain 'B':
    Compound: cyclin-dependent kinase 6 inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: P18(INK4C)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g3nb_
  • Chain 'C':
    Compound: v-cyclin
    Species: Human herpesvirus 8 [TaxId:37296]
    Gene: K-CYCLIN (VIRAL CYCLIND HOMOLOG)
    Database cross-references and differences (RAF-indexed):
    • Uniprot O40946
      • conflict (162)
      • conflict (187)
    Domains in SCOPe 2.06: d1g3nc1, d1g3nc2
  • Chain 'E':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLIN-DEPENDENT KINASE 6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g3ne_
  • Chain 'F':
    Compound: cyclin-dependent kinase 6 inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: P18(INK4C)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g3nf_
  • Chain 'G':
    Compound: v-cyclin
    Species: Human herpesvirus 8 [TaxId:37296]
    Gene: K-CYCLIN (VIRAL CYCLIND HOMOLOG)
    Database cross-references and differences (RAF-indexed):
    • Uniprot O40946
      • conflict (162)
      • conflict (187)
    Domains in SCOPe 2.06: d1g3ng1, d1g3ng2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3nA (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlerckenldshlppsqntselnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nA (A:)
    adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
    etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
    llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
    evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
    lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g3nB (B:)
    maepwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrg
    anpdlkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvve
    flvkhtasnvghrnhkgdtacdlarlygrnevvslmqangaggatnlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nB (B:)
    gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
    kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
    tasnvghrnhkgdtacdlarlygrnevvslmqang
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g3nC (C:)
    matannppsglldptlcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfs
    vcqeynlepnvvalalnlldrlllikqvskehfqktgsacllvasklrsltpistsslcy
    aaadsfsrqelidqekelleklawrteavlatdvtsflllklvggsqhldfwhhevntli
    tkalvdpltgslpasiisaagcallvpanvipqdthsggvvpqlasilgcdvsvlqaave
    qiltsvsdfdlrildsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nC (C:)
    lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
    lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
    kelleklawrteavlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpas
    iisaagcallvpanvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g3nE (E:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlerckenldshlppsqntselnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nE (E:)
    adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
    etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
    llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
    evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
    lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g3nF (F:)
    maepwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrg
    anpdlkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvve
    flvkhtasnvghrnhkgdtacdlarlygrnevvslmqangaggatnlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nF (F:)
    gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
    kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
    tasnvghrnhkgdtacdlarlygrnevvslmqang
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1g3nG (G:)
    matannppsglldptlcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfs
    vcqeynlepnvvalalnlldrlllikqvskehfqktgsacllvasklrsltpistsslcy
    aaadsfsrqelidqekelleklawrteavlatdvtsflllklvggsqhldfwhhevntli
    tkalvdpltgslpasiisaagcallvpanvipqdthsggvvpqlasilgcdvsvlqaave
    qiltsvsdfdlrildsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nG (G:)
    lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
    lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
    kelleklawrteavlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpas
    iisaagcallvpanvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri