PDB entry 1g3n

View 1g3n on RCSB PDB site
Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
Deposited on 2000-10-24, released 2001-01-10
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3nA (A:)
    adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
    etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
    llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
    evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
    lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3nB (B:)
    gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
    kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
    tasnvghrnhkgdtacdlarlygrnevvslmqang
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g3nC (C:)
    lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
    lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
    kelleklawrteavlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpas
    iisaagcallvpanvipqdthsggvvpqlasilgcdvsvlqaaveqiltsvsdfdlri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nC (C:)
    lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
    lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
    kelleklawrteavlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpas
    iisaagcallvpanvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3nE (E:)
    adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
    etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
    llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
    evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
    lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3nF (F:)
    gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
    kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
    tasnvghrnhkgdtacdlarlygrnevvslmqang
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1g3nG (G:)
    lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
    lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
    kelleklawrteavlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpas
    iisaagcallvpanvipqdthsggvvpqlasilgcdvsvlqaaveqiltsvsdfdlri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3nG (G:)
    lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
    lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
    kelleklawrteavlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpas
    iisaagcallvpanvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri