PDB entry 1g3k

View 1g3k on RCSB PDB site
Description: crystal structure of the h. influenzae protease hslv at 1.9 a resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2000-10-24, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ka_
  • Chain 'B':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3kb_
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3kc_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3kA (A:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3kA (A:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g3kB (B:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3kB (B:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g3kC (C:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3kC (C:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp