PDB entry 1g3j

View 1g3j on RCSB PDB site
Description: crystal structure of the xtcf3-cbd/beta-catenin armadillo repeat complex
Class: transcription
Keywords: Beta-catenin,Tcf-3, Protein-Protein Complex
Deposited on 2000-10-24, released 2000-12-11
The last revision prior to the SCOP 1.73 freeze date was dated 2001-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin armadillo repeat region
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g3ja_
  • Chain 'B':
    Compound: tcf3-cbd (catenin binding domain)
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g3jb_
  • Chain 'C':
    Compound: beta-catenin armadillo repeat region
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g3jc_
  • Chain 'D':
    Compound: tcf3-cbd (catenin binding domain)
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g3jd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3jA (A:)
    khavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrsp
    qmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvl
    fyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqesk
    liilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltd
    psqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnny
    knkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglp
    vvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrts
    mggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqr
    vaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3jA (A:)
    havvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspq
    mvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlf
    yaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskl
    iilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdp
    sqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyk
    nkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpv
    vvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrfve
    gvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcela
    qdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g3jB (B:)
    mpqlnsgggdelgandelirfkdegeqeekspgegsaegdladvksslvnesenhssdsd
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3jB (B:)
    pqlnsgggdelgandelirfkdegeqeedladvksslvnes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g3jC (C:)
    khavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrsp
    qmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvl
    fyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqesk
    liilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltd
    psqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnny
    knkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglp
    vvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrts
    mggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqr
    vaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3jC (C:)
    hhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlagglqkm
    vallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllwttsr
    vlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegmegll
    gtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdredite
    paicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnlalcpa
    nhaplreqgaiprlvqllvrahqdtqrrtsmgqqfvegvrmeeivegctgalhilardvh
    nrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapltellh
    srnegvatyaaavlfrmse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g3jD (D:)
    mpqlnsgggdelgandelirfkdegeqeekspgegsaegdladvksslvnesenhssdsd
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3jD (D:)
    pqlnsgggdelgandelirfkdedladvksslvn