PDB entry 1g3i

View 1g3i on RCSB PDB site
Description: crystal structure of the hsluv protease-chaperone complex
Class: chaperone/hydrolase
Keywords: chaperone/hydrolase
Deposited on 2000-10-24, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.41 Å
R-factor: 0.24
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ia_
  • Chain 'B':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ib_
  • Chain 'C':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ic_
  • Chain 'D':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3id_
  • Chain 'E':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ie_
  • Chain 'F':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3if_
  • Chain 'G':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ig_
  • Chain 'H':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ih_
  • Chain 'I':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ii_
  • Chain 'J':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ij_
  • Chain 'K':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ik_
  • Chain 'L':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3il_
  • Chain 'M':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3im_
  • Chain 'N':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3in_
  • Chain 'O':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3io_
  • Chain 'P':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ip_
  • Chain 'Q':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3iq_
  • Chain 'R':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ir_
  • Chain 'S':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3is_
  • Chain 'T':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3it_
  • Chain 'U':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3iu_
  • Chain 'V':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3iv_
  • Chain 'W':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3iw_
  • Chain 'X':
    Compound: ATP-dependent hslu protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3ix_
  • Heterogens: ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3iA (A:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iA (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknriddeaakl
    inpeelkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmv
    ktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqyka
    lmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqt
    vnidaayvadalgevvenedlsrfil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g3iB (B:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iB (B:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknriddeaakl
    inpeelkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmv
    ktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqyka
    lmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqt
    vnidaayvadalgevvenedlsrfil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g3iC (C:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iC (C:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknrainpeelk
    qkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhilf
    iasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategv
    niafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaay
    vadalgevvenedlsrfil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g3iD (D:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iD (D:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknranpeelkq
    kaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhilfi
    asgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvn
    iafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayv
    adalgevvenedlsrfil
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g3iE (E:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iE (E:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknrnpeelkqk
    aidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g3iF (F:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iF (F:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknrarinpeel
    kqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhil
    fiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmateg
    vniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaa
    yvadalgevvenedlsrfil
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1g3iG (G:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iG (G:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1g3iH (H:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iH (H:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1g3iI (I:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iI (I:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1g3iJ (J:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iJ (J:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1g3iK (K:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iK (K:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1g3iL (L:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iL (L:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1g3iM (M:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iM (M:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1g3iN (N:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iN (N:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1g3iO (O:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iO (O:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1g3iP (P:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iP (P:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1g3iQ (Q:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iQ (Q:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1g3iR (R:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iR (R:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1g3iS (S:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iS (S:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1g3iT (T:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iT (T:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknraraedvaeidde
    aaklinpeelkqkaidaveqngivfideidkickksgadvsregvqrdllplvegstvst
    khgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslt
    eqykalmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasd
    mngqtvnidaayvadalgevvenedlsrfil
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1g3iU (U:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iU (U:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrddeaaklinpee
    lkqkaidaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdh
    ilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmat
    egvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnid
    aayvadalgevvenedlsrfil
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1g3iV (V:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iV (V:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknnpeelkqkaidav
    eqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfiasgaf
    qvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniaftt
    davkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalg
    evvenedlsrfil
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1g3iW (W:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iW (W:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknreelkqkaidave
    qngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafq
    varpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttd
    avkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalge
    vvenedlsrfil
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1g3iX (X:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3iX (X:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiakniddeaaklinpee
    lkqkaidaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdh
    ilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmat
    egvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnid
    aayvadalgevvenedlsrfil