PDB entry 1g3g

View 1g3g on RCSB PDB site
Description: nmr structure of the fha1 domain of yeast rad53
Class: transferase
Keywords: FHA domain, Rad53, Phosphopeptide, Phosphoprotein, TRANSFERASE
Deposited on 2000-10-24, released 2001-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-02, with a file datestamp of 2020-08-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein kinase spk1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SPK1 or Rad53
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22216 (0-163)
    • engineered (0)
  Domains in SCOPe 2.08: d1g3ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g3gA (A:)
  genitqptqqstqatqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekr
  sikkvwtfgrnpacdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkvekns
  nqllsqgdeitvgvgvesdilslvifindkfkqcleqnkvdrir