PDB entry 1g3f

View 1g3f on RCSB PDB site
Description: nmr structure of a 9 residue peptide from smac/diablo complexed to the bir3 domain of xiap
Class: apoptosis
Keywords: zinc finger, complex, peptide-protein, apoptosis, BIR
Deposited on 2000-10-24, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of apoptosis protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (1-116)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1g3fa1, d1g3fa2
  • Chain 'B':
    Compound: smac
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g3fA (A:)
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

  • Chain 'B':
    No sequence available.