PDB entry 1g3d

View 1g3d on RCSB PDB site
Description: bovine beta-trypsin bound to meta-amidino schiff base copper (ii) chelate
Deposited on 2000-10-23, released 2001-01-17
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g3da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g3dA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn