PDB entry 1g3d

View 1g3d on RCSB PDB site
Description: bovine beta-trypsin bound to meta-amidino schiff base copper (II) chelate
Class: hydrolase
Keywords: enzyme-inhibitor complex, coordination metal based inhibitor, hydrolase
Deposited on 2000-10-23, released 2001-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g3da_
  • Heterogens: CU, CA, SO4, 108, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g3dA (A:)
    ddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedni
    nvvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtq
    clisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqg
    dsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g3dA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn