PDB entry 1g38

View 1g38 on RCSB PDB site
Description: adenine-specific methyltransferase m. taq I/DNA complex
Class: transferase/DNA
Keywords: transferase, DNA, methyltransferase, restriction system
Deposited on 2000-10-23, released 2001-03-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase taqi
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g38a1, d1g38a2
  • Chain 'B':
    Compound: 5'-d(*gp*tp*tp*cp*gp*ap*tp*gp*tp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*ap*cp*ap*tp*cp*gp*(6ma)p*ap*c)-3'
  • Chain 'D':
    Compound: modification methylase taqi
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g38d1, d1g38d2
  • Chain 'E':
    Compound: 5'-d(*gp*tp*tp*cp*gp*ap*tp*gp*tp*c)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*ap*cp*ap*tp*cp*gp*(6ma)p*ap*c)-3'
  • Heterogens: NEA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g38A (A:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
    nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
    vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmpl
    gdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerak
    elrdfyatphlvvahtkgtrvvaawderaypwreefhllpkegvrldpsslvqwlnseam
    qkhvrtlyrdfvphltlrmlerlpvrreygfht
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g38D (D:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
    nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
    vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmpl
    gdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerak
    elrdfyatphlvvahtkgtrvvaawderaypwreefhllpkegvrldpsslvqwlnseam
    qkhvrtlyrdfvphltlrmlerlpvrreygfht
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.