PDB entry 1g38

View 1g38 on RCSB PDB site
Description: adenine-specific methyltransferase m. taq i/dna complex
Deposited on 2000-10-23, released 2001-03-05
The last revision prior to the SCOP 1.71 freeze date was dated 2001-03-12, with a file datestamp of 2001-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g38A (A:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
    nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
    vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmpl
    gdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerak
    elrdfyatphlvvahtkgtrvvaawderaypwreefhllpkegvrldpsslvqwlnseam
    qkhvrtlyrdfvphltlrmlerlpvrreygfht
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g38D (D:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
    nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
    vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmpl
    gdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerak
    elrdfyatphlvvahtkgtrvvaawderaypwreefhllpkegvrldpsslvqwlnseam
    qkhvrtlyrdfvphltlrmlerlpvrreygfht