PDB entry 1g34

View 1g34 on RCSB PDB site
Description: trypsin inhibitor complex
Class: hydrolase
Keywords: blood coagulation, factor Xa, inhibitor complexes, serine proteinase, blood coagulation cascade
Deposited on 2000-10-23, released 2001-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-04-29, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsinogen, cationic
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g34a_
  • Heterogens: CA, SO4, T87, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g34A (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn