PDB entry 1g2x

View 1g2x on RCSB PDB site
Description: Sequence induced trimerization of krait PLA2: crystal structure of the trimeric form of krait PLA2
Class: toxin
Keywords: Phospholipase A2, Homotrimer, Bungarus caeruleus, TOXIN
Deposited on 2000-10-22, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2xa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2xb_
  • Chain 'C':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2xc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2xA (A:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2xB (B:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2xC (C:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq