PDB entry 1g2x
View 1g2x on RCSB PDB site
Description: Sequence induced trimerization of krait PLA2: crystal structure of the trimeric form of krait PLA2
Class: toxin
Keywords: Phospholipase A2, Homotrimer, Bungarus caeruleus, TOXIN
Deposited on
2000-10-22, released
2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1g2xa_ - Chain 'B':
Compound: phospholipase a2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1g2xb_ - Chain 'C':
Compound: phospholipase a2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1g2xc_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1g2xA (A:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1g2xB (B:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1g2xC (C:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq