SCOPe 2.08: Structural Classification of Proteins

PDB entry 1g2v

View 1g2v on RCSB PDB site
Description: the structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). ttp complex.
Class: transferase
Keywords: l-rhamnose, nucleotidyltransferase, pyrophosphorylase, thymidylyltransferase, allostery, transferase
Deposited on 2000-10-21, released 2000-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2va_
Chain 'B':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2vb_
Chain 'C':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2vc_
Chain 'D':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2vd_
Chain 'E':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2ve_
Chain 'F':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2vf_
Chain 'G':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2vg_
Chain 'H':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU22 (Start-292)
Domains in SCOPe 2.08: d1g2vh_
Heterogens: TTP

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1g2vA (A:)
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy