PDB entry 1g2t

View 1g2t on RCSB PDB site
Description: solution structure of eotaxin-3
Class: cytokine
Keywords: beta-beta-beta-alpha helix, CYTOKINE
Deposited on 2000-10-20, released 2002-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eotaxin-3
  Species: Homo sapiens [TaxId:9606]
  Gene: EOTAXIN-3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y258 (0-70)
  Domains in SCOPe 2.08: d1g2ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g2tA (A:)
  trgsdisktccfqyshkplpwtwvrsyeftsnscsqravifttkrgkkvcthprkkwvqk
  yisllktpkql