PDB entry 1g2s

View 1g2s on RCSB PDB site
Description: solution structure of eotaxin-3
Class: cytokine
Keywords: beta-beta-beta-alpha helix, CYTOKINE
Deposited on 2000-10-20, released 2002-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eotaxin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: EOTAXIN-3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g2sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2sA (A:)
    trgsdisktccfqyshkplpwtwvrsyeftsnscsqravifttkrgkkvcthprkkwvqk
    yisllktpkql