PDB entry 1g2o

View 1g2o on RCSB PDB site
Description: crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with a transition-state inhibitor
Class: transferase
Keywords: trimer, transition-state complex, TRANSFERASE
Deposited on 2000-10-20, released 2001-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2oa_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2ob_
  • Chain 'C':
    Compound: purine nucleoside phosphorylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2oc_
  • Heterogens: PO4, IMH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g2oA (A:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g2oA (A:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g2oB (B:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g2oB (B:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g2oC (C:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g2oC (C:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf