PDB entry 1g2i

View 1g2i on RCSB PDB site
Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution
Class: hydrolase
Keywords: intracellular protease, ATP-independent intracellular protease, protease, catalytical triad, PfpI, cysteine protease, nucleophile elbow, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, PSI, Protein Structure Initiative
Deposited on 2000-10-19, released 2000-11-08
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease I
    Species: Pyrococcus horikoshii
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413 (0-165)
      • modified residue (0)
      • modified residue (88)
      • modified residue (126)
      • modified residue (157)
    Domains in SCOP 1.73: d1g2ia_
  • Chain 'B':
    Compound: protease I
    Species: Pyrococcus horikoshii
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413
      • modified residue (0)
      • modified residue (88)
      • modified residue (126)
      • modified residue (157)
    Domains in SCOP 1.73: d1g2ib_
  • Chain 'C':
    Compound: protease I
    Species: Pyrococcus horikoshii
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413
      • modified residue (0)
      • modified residue (88)
      • modified residue (126)
      • modified residue (157)
    Domains in SCOP 1.73: d1g2ic_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2iA (A:)
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2iB (B:)
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2iC (C:)
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk